PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do004161.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family NAC
Protein Properties Length: 329aa    MW: 36473.5 Da    PI: 8.1409
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do004161.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM180.73.8e-5651301128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgel 99 
                 lppGfrFhPtdeelv++yL++kv++  +++ ++i++vd++k+ePwdLp+k++ +ekewyfFs rd+ky+tg r+nrat+sgyWk+tgkdke+++  g l
  Do004161.1   5 LPPGFRFHPTDEELVTYYLTRKVSDFAFTT-RAIADVDLNKCEPWDLPSKARMGEKEWYFFSMRDRKYPTGIRTNRATDSGYWKTTGKDKEIFH-CGML 101
                 79*************************999.89***************999999****************************************.99** PP

         NAM 100 vglkktLvfykgrapkgektdWvmheyrl 128
                 vg+kktLvfy+grapkgekt+Wvmheyrl
  Do004161.1 102 VGMKKTLVFYRGRAPKGEKTSWVMHEYRL 130
                 ***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.05E-643151IPR003441NAC domain
PROSITE profilePS5100560.3955151IPR003441NAC domain
PfamPF023653.1E-296130IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MEEGLPPGFR FHPTDEELVT YYLTRKVSDF AFTTRAIADV DLNKCEPWDL PSKARMGEKE  60
WYFFSMRDRK YPTGIRTNRA TDSGYWKTTG KDKEIFHCGM LVGMKKTLVF YRGRAPKGEK  120
TSWVMHEYRL QNKFPYKPNK EEWVVCRVFK KFQIIKMRPP QGSPTMDSPC HDGNASLGEL  180
GELDVSSILG GFAPAAVHTS SGSPGALHHQ GAGESFGHRV DMSAYMSWMA AASQGAAAAM  240
LPWATTPGLF GNVFAAPNHQ LVQKPLPFAG CSQPRDLGGV VANVGSEHAA MFASSLAKVE  300
MECDRQQPSP ATATEQQLGM DVESTWRAF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B7e-57515117165NAC domain-containing protein 19
4dul_A7e-57515117165NAC domain-containing protein 19
1ut7_B7e-57515117165NO APICAL MERISTEM PROTEIN
1ut7_A7e-57515117165NO APICAL MERISTEM PROTEIN
1ut4_B7e-57515117165NO APICAL MERISTEM PROTEIN
1ut4_A7e-57515117165NO APICAL MERISTEM PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00364DAPTransfer from AT3G18400Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3631710.0AK363171.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2013D22.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004982400.10.0PREDICTED: protein CUP-SHAPED COTYLEDON 1-like
TrEMBLK4ACC80.0K4ACC8_SETIT; Uncharacterized protein
STRINGSi036535m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP79193450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18400.12e-93NAC domain containing protein 58